PPP2R5E Rabbit Polyclonal Antibody TA345141 from OriGene Technologies | Biocompare.com

Supplier Images

PPP2R5E Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
PPP2R5E Rabbit Polyclonal Antibody

The PPP2R5E Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Mouse antigen. The PPP2R5E Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region

Product Specs
ItemPPP2R5E Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA345141
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetPPP2R5E
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Ppp2r5e antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP
NCBI Full Gene Nameprotein phosphatase 2 regulatory subunit B'epsilon
NCBI Gene AliasesB56E, B56epsilon
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!